PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G17070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 310aa    MW: 33081.3 Da    PI: 7.7553
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G17070.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.24e-181663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++lvd+v+++G g+W++ +++ g++R+ k+c++rw +yl
  LPERR03G17070.1 16 KGPWTREEDQKLVDYVELHGHGSWRSLPKRAGLNRCCKSCRLRWINYL 63
                     79********************************************97 PP

2Myb_DNA-binding54.62.6e-1769112146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eE++ ++ ++  lG++ W+tIa +++ gRt++++k++w++
  LPERR03G17070.1  69 RGNFTPEEEQAIITLHSVLGNK-WSTIATRLP-GRTDNEIKNYWNT 112
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-25766IPR009057Homeodomain-like
PROSITE profilePS5129418.2671163IPR017930Myb domain
SuperFamilySSF466891.87E-3113110IPR009057Homeodomain-like
SMARTSM007171.9E-151565IPR001005SANT/Myb domain
PfamPF002492.1E-161663IPR001005SANT/Myb domain
CDDcd001676.58E-131863No hitNo description
PROSITE profilePS5129426.74264118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2767118IPR009057Homeodomain-like
SMARTSM007174.3E-1668116IPR001005SANT/Myb domain
PfamPF002492.4E-1569112IPR001005SANT/Myb domain
CDDcd001673.04E-1271114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MGRLRPPCCD ESSVKKGPWT REEDQKLVDY VELHGHGSWR SLPKRAGLNR CCKSCRLRWI  60
NYLRPDIKRG NFTPEEEQAI ITLHSVLGNK WSTIATRLPG RTDNEIKNYW NTRLKKRLIV  120
AGIDPATHRA RARPPAPADL AAALPQLVAL ASLAVDLAVG HAGAAAAWGA NSAALDFHAA  180
DNTAAQLQCL QHLLLQQQQP TPATSATSGD MNTASCSFLV NQYAAAAATN PLPLPPLMAA  240
SNTQAHELKR WQDLVGNDGG GCGDHHGAGV SPPFAGGDGG EGGMFLPSDL TALLCSANST  300
ADLQSSNLDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28161187108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631094.11e-128PREDICTED: transcription factor MYB39
TrEMBLA0A0D9VUR80.0A0A0D9VUR8_9ORYZ; Uncharacterized protein
STRINGLOC_Os03g27090.11e-128(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP180181010
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.22e-68myb domain protein 9